| Sequence 1: | NP_723797.3 | Gene: | l(2)k05911 / 34731 | FlyBaseID: | FBgn0284244 | Length: | 639 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006525784.1 | Gene: | Proc / 19123 | MGIID: | 97771 | Length: | 484 | Species: | Mus musculus |
| Alignment Length: | 49 | Identity: | 10/49 - (20%) |
|---|---|---|---|
| Similarity: | 23/49 - (46%) | Gaps: | 1/49 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 64 MMKVLITMGTAVQLYIKFFVAHSKAQEVKLFTVELEQEVLKRYQNGSEE 112 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| l(2)k05911 | NP_723797.3 | CLIP | 111..174 | CDD:197829 | 0/2 (0%) |
| PTZ00449 | <198..>376 | CDD:185628 | |||
| Tryp_SPc | 400..637 | CDD:238113 | |||
| Proc | XP_006525784.1 | GLA | 50..110 | CDD:214503 | |
| EGF_CA | 111..155 | CDD:238011 | |||
| FXa_inhibition | 163..198 | CDD:464251 | |||
| Tryp_SPc | 236..470 | CDD:238113 | 5/26 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||