DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k05911 and CG12256

DIOPT Version :9

Sequence 1:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:255 Identity:82/255 - (32%)
Similarity:125/255 - (49%) Gaps:37/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 QERIVGGINASPHEF-PW---IAVLFKSGK--QFCGGSLITNSHILTAAHCVARMTSWDVAALTA 455
            |||:|||.:....|: |:   :..|.:|||  .|||||||..:.:|||||||....:..: ::.|
  Fly    44 QERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRI-SVVA 107

  Fly   456 HLGDYNIGTDFEVQ----HVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPF-TREIQPICLPT 515
            .:.|.|..:.|..|    .::...:.||.          :|:|||.:..|... .:.:..|    
  Fly   108 GIRDLNDSSGFRSQVQSYEMNENYQELVT----------SDIAILKIDPPFELDEKRVSTI---- 158

  Fly   516 SPSQQSRSYSGQVATVAGWGSLRE--NGP---QPSILQKVDIPIWTNAECARKYGRAAPGGIIES 575
            ..|......:.|...:.||||:..  .||   .|::|||:|....:|::|.....:     :.::
  Fly   159 DVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMTQ-----LTDT 218

  Fly   576 MICA-GQAAKDSCSGDSGGPMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWI 634
            .||| .:..|.:|:||||||:|:..|..|.|||:||:|........|.|||||:....||
  Fly   219 EICALERFGKGACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 78/251 (31%)
Tryp_SPc 400..637 CDD:238113 79/252 (31%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 78/251 (31%)
Tryp_SPc 47..280 CDD:238113 79/252 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.