DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG17189

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster


Alignment Length:231 Identity:48/231 - (20%)
Similarity:99/231 - (42%) Gaps:15/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPEF--NMDSIDPYFYKRGIFRYTNDGIQG-GLLI 146
            :..|.:..|:..:|....||:|..:| .:||||.  :...|||...::.:|:..|..:.. ...:
  Fly    30 IESCKIYEPEFTKCSTRSIQAFMNQL-VKGVPEIEESFGPIDPMRQEQLVFKQDNSDVATLSANL 93

  Fly   147 KNMEIYGISQLQVNSVAANFTDNGFIIKLGVELPQLKAGGHFKADVKFGGLRLVP---KGPFNIT 208
            .:|.|.|..::.:.....:..|..::.|  :.|||::..||:|   ..|.:.|||   .|...:.
  Fly    94 TDMLIRGFGKMLIKESKVSKKDFSWLTK--IYLPQMRIDGHYK---MVGRILLVPLQGNGKIVME 153

  Fly   209 IDNIKATILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFS--DRNLNAMILNLVNENL 271
            ||::...:.|...:.: ..|....::..:...|::|..:...:.:|:  .:.:........|:|.
  Fly   154 IDDLDILMTTKTRLYE-KGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDNW 217

  Fly   272 PEITRVGIPATREQWAPILIAHINEFFAKVPIEKFL 307
            .::.....|...|.....|:..:::.||..|...|:
  Fly   218 KDVFEALRPLVVETVERTLLDLLHKTFALFPASFFV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 48/231 (21%)
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 48/231 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.