DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG14259

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:254 Identity:50/254 - (19%)
Similarity:90/254 - (35%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CSLNSPDLNECIRGLIQSFAPKLRYQGVPEF--NMDSIDPYFYKRGIFRYTNDGIQGGLLIKNME 150
            |.:..|...:|....||....:|.. |:||.  .....||...:..:|:..|:            
  Fly    49 CRIYEPGFTKCSTNSIQKLLDQLNI-GIPEVLERFGPFDPMRVRDIVFKQDNN------------ 100

  Fly   151 IYGISQLQVNSVAANFTD------------------NGFIIKLGVELPQLKAGGHFKADVKFGGL 197
                   :|.::.||.||                  ..|..:..:.||:::..|.::   ..|.:
  Fly   101 -------EVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYE---MAGRI 155

  Fly   198 RLVP---KGPFNITIDNIKATILTDGHI--------EQLPSGQQRLSLHRLNA---NVNIGDAKV 248
            .|:|   .|...|.||::...:||...:        :.:.:.|.:|:|.::..   |:..|.:|.
  Fly   156 LLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLSKVRTYLDNLFNGRSKE 220

  Fly   249 VANGIFSDRNLNAMILNLVNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIEKFL 307
            |      :|:.|    ...|||..:......|...|....||...::..|..:|...|:
  Fly   221 V------ERSTN----EFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 50/254 (20%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 49/252 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.