DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG14258

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster


Alignment Length:261 Identity:56/261 - (21%)
Similarity:108/261 - (41%) Gaps:37/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SHVAVPSSSIDFAVAPASVTLSSGSNEVTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPEFN-MD 121
            |.|||..|:::     .:..|:...:.:.||.:..|:.|.|:....|||..:.: .|:|.:| :.
  Fly    10 SIVAVLLSAVE-----GAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWK-DGIPGYNAVG 68

  Fly   122 SIDPYFYKRGIFRYTNDGIQGGLL---IKNMEIYGISQLQVNSVAANFTDNGFIIKLGVELPQLK 183
            |.||::.||  .::|.|..:...:   :|.:.:.|..|..|  :.:::..|.::.:..:.:|:|:
  Fly    69 SFDPFYIKR--VKFTQDASRSIAINADLKEVYVAGAGQALV--LESSWDPNHYVARTLISVPKLR 129

  Fly   184 AGGHFKADVKFGGLRLVPKGPFNITIDN--------IKATILTDGHIEQLPSGQQRLSLHRLNAN 240
            ....:|.......|.|...|......:|        :|....:||:...:.|           ..
  Fly   130 FNFDYKVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADVQS-----------VK 183

  Fly   241 VNIGDAK---VVANGIF-SDRNLNAMILNLVNENLPEITRVGIPATREQWAPILIAHINEFFAKV 301
            ||..:.|   :....:| .:::|......|.|||..:...|..||..:....:|:....:.|..|
  Fly   184 VNFREIKQFRIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVYV 248

  Fly   302 P 302
            |
  Fly   249 P 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 50/240 (21%)
CG14258NP_651531.1 JHBP 13..255 CDD:284096 54/258 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.