DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG11854

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster


Alignment Length:218 Identity:45/218 - (20%)
Similarity:90/218 - (41%) Gaps:10/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 ECIRGLIQSFAPKLRYQGVPEFNMDSIDPYFYKR-GIFRYTNDGIQGGLLIKNMEIYGISQLQVN 160
            :|:...:..........|:.|..:..:||...|: .|.|..:..:...|....|:|.|:.|....
  Fly    36 QCLEDRVNFVLRNYAKSGIKELGLIPLDPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVAK 100

  Fly   161 SVAANFTDNGFIIKLGVELPQLKAGGHFKADVKFGGLRLVPKG--PFNITIDNIKATILTDGHIE 223
            .|:....|....|:|.:|:|::...|.:..|.:...|.:...|  ...:|...::|.|    .::
  Fly   101 RVSGFTRDLSRSIELVMEVPEIGVRGPYSVDGRILILPITGNGIADIRLTRTKVRAQI----KLK 161

  Fly   224 QLPSGQQRLSLHRLNANVNIGDAKV---VANGIFSDRNLNAMILNLVNENLPEITRVGIPATREQ 285
            ::..|..:.....:|..|.:..:.|   :.|.....::|:..:..|:|||..:|.....|...|.
  Fly   162 RVSKGDHQTYAEVMNIKVELDPSHVTYQLENLFNGQKDLSENMHALINENWKDIFNELKPGIGEA 226

  Fly   286 WAPILIAHINEFFAKVPIEKFLV 308
            :..|..:.::..|.|:|:|:..|
  Fly   227 FGLIAKSVVDRIFGKLPLEQLFV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 44/216 (20%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 44/216 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.