DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG13618

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster


Alignment Length:252 Identity:50/252 - (19%)
Similarity:100/252 - (39%) Gaps:39/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SVTLSSGSNEVTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPEFNMDSIDPYFYKRGIFRYTNDG 139
            :||.:....|..|......:.::|:...:.....:|: .|..||.:..::|...|:.:....|..
  Fly    21 TVTAAQELPEGFPKCKRDANFDKCLVDAVNVAIQQLK-AGNREFGIPPLEPLTVKKLVIDAGNAP 84

  Fly   140 IQGGLLIKNMEIYGISQLQVNSVAANFTD-NGFIIKLGVELPQLKAGGHFKADVKFGGLRLVP-- 201
            |.....:||::::  ..:..:.:....|| :..:|.......:::..|.::..   |.:.|:|  
  Fly    85 INLRQALKNVKVH--DMISTSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEMS---GRILLLPIT 144

  Fly   202 -KGPFNITIDNIKATILTDGHIEQLPSGQ---------QRLSLHRLNANVNIGDAKVVAN--GIF 254
             .|..|:|:.|.|        ||....|:         .||..:|    |:....:|..|  .:|
  Fly   145 GHGKANVTLINTK--------IEHRLIGEPFEKDGVKYMRLKDYR----VSFDPKRVYMNFENLF 197

  Fly   255 SDRNLNAMILNLVNENLPEI---TRVGIPATREQWAPILIAHINEFFAKVPIEKFLV 308
            :|:.|:..:...:|||...:   .:||.   .:.:..|.....|:.|.|||.:...:
  Fly   198 NDKTLSDGMNRFLNENWETVFNELKVGY---AKSFGIIFRELSNKLFEKVPFDNIFL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 48/246 (20%)
CG13618NP_651265.1 JHBP 13..251 CDD:284096 50/250 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.