DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG7079

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:240 Identity:48/240 - (20%)
Similarity:84/240 - (35%) Gaps:61/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LNECIRGLIQSFAPKLRYQGVPE-----FNMDSIDPYFYKRGIFRYTNDGIQGGL-----LIKNM 149
            |.|....|::.| ||    |:||     ||:.|:..:.       ..||...||.     ||..:
  Fly    37 LVESANALLRDF-PK----GIPEVDLKPFNVLSVRDWL-------LVNDSQVGGAWYYFNLINQI 89

  Fly   150 EIYGISQLQVNSVAANFTDNGF-------IIKLGVELPQLKAGGHFKADVKFGGLRLVPKGPFNI 207
            . ||.....:..:      .||       .|::..::|:|...|.:           |.||....
  Fly    90 N-YGFENTTITEI------RGFDKDPTTTKIEIHGKIPRLVYKGDY-----------VAKGRMLW 136

  Fly   208 TID------------NIKATILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFSD-RNL 259
            .:|            |.:..:.....:| ..:.::.|.::.|..|:.:....:..:..|.| .:|
  Fly   137 FVDIHSQGTSESDFLNFQFVLTLKVRVE-YRNNKRYLKIYELVPNIRLDRWIMWLDNFFPDNEDL 200

  Fly   260 NAMILNLVNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIE 304
            ...:.||.|.|..|......|.....:..:.::...:.|.|||.:
  Fly   201 TIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 48/240 (20%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 48/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.