DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG31189

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster


Alignment Length:227 Identity:50/227 - (22%)
Similarity:89/227 - (39%) Gaps:53/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PASVTLSSGSNEVTPCSL-NSPDLNECIRGLIQSFAPKLRYQGVPEFNMDSIDPYFYKRGI---- 132
            |..::.:|...:|..|.. :|..|...|..||:.: ||    |:||..:..:|.|.:...:    
  Fly    15 PVMISGASLPEDVEKCHFGDSTCLVRSINALIKHY-PK----GIPEIGLPPLDAYNFPDSVIMES 74

  Fly   133 ---------FRYTNDGIQGGL---LIKNME--IYGISQLQVNSVAANFTDNGFIIKLGVELPQLK 183
                     || ..|.:..|.   .|.::|  :|..:|.|              |.|.|.||:|.
  Fly    75 PSRGPIWMDFR-MRDNVNKGFNNATITHVEGFLYEPNQKQ--------------IVLKVRLPRLV 124

  Fly   184 AGGHFKADVKFGGLRLVPKGPFNIT------IDNIKATILTDGHIEQLPSGQQRLSLHRLNANVN 242
                .:|.....|..|:  ..||.|      ..|.:.| ||...:.:..:.::.|.::.|..:::
  Fly   125 ----HEATYDMSGRVLL--FFFNTTGRLISDFQNFRIT-LTIKALVEYRNDKRYLKIYNLVPSLD 182

  Fly   243 IGDAKVVANGIFSDRNLNAMILN-LVNENLPE 273
            :....:..:|::.:.....:.:| |.|||..|
  Fly   183 LDRWIIWLDGLYKENTDVTIFMNKLFNENWVE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 49/221 (22%)
CG31189NP_732580.3 JHBP 9..249 CDD:284096 50/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.