DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG10407

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster


Alignment Length:275 Identity:57/275 - (20%)
Similarity:111/275 - (40%) Gaps:46/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SSPVEELAAQTPSFSDSHVAVPSSSIDFAVAPASVTLSSGSNEVTPCSLNSPDLNECIRGLIQSF 106
            :.|..:.|.|.|||                             :..|..|:|||:.|:|...:..
  Fly    24 AKPPAKKADQLPSF-----------------------------LKVCHRNAPDLDTCVRESYEEL 59

  Fly   107 APKLRYQGVPEFNMDSIDPYFYKRGIFRYTNDGIQGGLLIKNMEIYGISQLQVNSVAANFTDNGF 171
            .|:| .:|:||..:.:::|....:......:..|....:.:|:::.|||:..||.:....:...|
  Fly    60 RPRL-MEGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSVYRNVKVTGISKHTVNELRLEPSKLKF 123

  Fly   172 IIKLGVELPQLKAGGHFKADVKF-----GGLRLVP-KGPFNITIDNIKATILTD--GHIEQLPSG 228
            |:.|  ..|:|    |.::|...     |.:.::| .|..:..:|.:..|:.|:  |. |...:|
  Fly   124 ILSL--TFPKL----HMESDYSIKVSREGKIMMMPLLGDGHCKVDLVNITMRTELIGQ-EYKKNG 181

  Fly   229 QQRLSLHRLNANVNIGDAKVVANGIFS-DRNLNAMILNLVNENLPEITRVGIPATREQWAPILIA 292
            ...|.::.:.....:.|..:..:.:|: |:.|...:...:|||...:.....|...:....||.|
  Fly   182 ANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENWKALAEEVRPLMTKALVDILRA 246

  Fly   293 HINEFFAKVPIEKFL 307
            .:::.||....:..|
  Fly   247 SVDKLFASFSYDDLL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 51/238 (21%)
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 56/271 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.