DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG33680

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster


Alignment Length:193 Identity:41/193 - (21%)
Similarity:74/193 - (38%) Gaps:44/193 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPE-FNMDSIDPYFYKRGIFRYTNDGIQGGLLIKN 148
            :|||:.|.|.|..||........|.|.:..:.: |....::|                  |.:.|
  Fly    35 ITPCARNEPLLERCIINAAYQIRPLLVHGNLGDGFPTSPLEP------------------LSLDN 81

  Fly   149 MEIYGISQLQ-----VNSVAANFTDNGFIIKLGVELPQLKAGGHFKADVKFGGLRLVPKGPFNIT 208
            :|:...||.|     :.:...|:|.. :.:.|.:.||.:|..|:.:.                 .
  Fly    82 IELKLSSQFQAVFKDLEANGGNYTGK-YSLHLNLLLPDIKGKGNMQG-----------------Y 128

  Fly   209 IDNIKATILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFS-DRNLNAMILNLVNEN 270
            .:|.||.:...|. ..|.:|:..:...::...::..|.|:....:|| ||.|..:..:|:|.|
  Fly   129 CENAKAFVKIRGS-RYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNN 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 41/193 (21%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 41/193 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.