DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG5867

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster


Alignment Length:226 Identity:66/226 - (29%)
Similarity:124/226 - (54%) Gaps:2/226 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 EVTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPEFNMDSIDPYFYKRGIFRYTNDGIQGGLLIKN 148
            ::..|.....:::|||:..:|...|:::| |:.|.|:..:||:...:..:.||:..:||.:.:||
  Fly    38 DIPTCREGDINISECIKQGLQQITPRMKY-GISELNIPPLDPFEMGKSSYSYTSGLLQGRISMKN 101

  Fly   149 MEIYGISQLQVNSVAANFTDNGFIIKLGVELPQLKAGGHFKADVKFGGLRLVPKGPFNITIDNIK 213
            :.|:|:|:..|:.|.....|....:::...:||:...|.:|||:|...|:|.|||.||||:.::.
  Fly   102 VVIHGLSEGIVDKVNFRLKDGRVRMEILSHVPQMFVEGLYKADIKLNDLKLNPKGAFNITMTDVA 166

  Fly   214 ATILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFSDRNLNAMILNLVNENLPEITRVG 278
            ......|.:.: ..|...|.|.:|.....:||.|..|||:..|..||.:||:.:|:...::.:..
  Fly   167 MRARPIGELYE-RDGHTYLRLTKLETEPKVGDLKFYANGLVPDPVLNDVILDFINQYWRQLYQAM 230

  Fly   279 IPATREQWAPILIAHINEFFAKVPIEKFLVQ 309
            :|.|.:.|.|:::...|:|||.:|.:..:.:
  Fly   231 LPETLDTWQPLILKSTNDFFAALPFDMLVTK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 66/223 (30%)
CG5867NP_609625.2 JHBP 34..260 CDD:214779 66/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470311
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DDPC
Homologene 1 1.000 - - H51243
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26555
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012728
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.