DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16820 and CG3246

DIOPT Version :9

Sequence 1:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster


Alignment Length:138 Identity:29/138 - (21%)
Similarity:56/138 - (40%) Gaps:28/138 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 IKNMEIYGISQLQVNSVAANFTD---NGFIIKLGVELPQLKAGGHFKADVKFGGLRLVPKGPFNI 207
            :|.::.||:|:.:::.:..:..:   ||     |::|.|:...|.:.....|.    ...|||.:
  Fly    93 MKQVKAYGLSKFRIDKMNLDLKEMRFNG-----GLQLDQMLVKGQYTLSSFFS----KANGPFTV 148

  Fly   208 TIDNIKATILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFSDRNLNAMILNLVNENLP 272
            .:.|:.|.......:|:  .||  |:..|:..::.           |||..::...|.||.....
  Fly   149 VLKNVYAEATAFLAVER--DGQ--LATDRIKIDIT-----------FSDMTMDFQNLGLVGSVFQ 198

  Fly   273 EITRVGIP 280
            .:.. |.|
  Fly   199 SVVN-GAP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16820NP_609627.1 JHBP 79..308 CDD:214779 29/138 (21%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 29/138 (21%)
Grp7_allergen 260..418 CDD:293589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.