DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5945 and CG14258

DIOPT Version :9

Sequence 1:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster


Alignment Length:269 Identity:67/269 - (24%)
Similarity:107/269 - (39%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSLLALGCSAAPTDKNYFADLP----KCSTEEDQLGECVKQLFNTLTPRLKDGNPELR-IEPYEP 67
            ||::|:..||....| |.|:.|    .|...:.....|:.:.|.:...:.|||.|... :..::|
  Fly     9 LSIVAVLLSAVEGAK-YLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPGYNAVGSFDP 72

  Fly    68 LHLNRTSFQYSSGTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKL-----------RLVTQM 121
            .::.|..|...:    .|....||.:        |||.|...|..:.|           |.:..:
  Fly    73 FYIKRVKFTQDA----SRSIAINADL--------KEVYVAGAGQALVLESSWDPNHYVARTLISV 125

  Fly   122 PKLNIVGSYKADMQVNQLQLK--PKGEF---NVTL---LDVEAITVTDGEVYEKDGHRF-FRLKN 177
            |||.....||....|:.|.|.  .||.|   |..|   |.|:.:..:||...:....:. ||   
  Fly   126 PKLRFNFDYKVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADVQSVKVNFR--- 187

  Fly   178 IDSKPKIKDLVIKANGIF-ADPELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFEL 241
                 :||...||...:| .:.:|:..|..:.|:.|||.:.::.|...|....::|..|.:.|..
  Fly   188 -----EIKQFRIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVY 247

  Fly   242 VPIDQFLKE 250
            ||....:|:
  Fly   248 VPATYLIKD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 61/252 (24%)
CG14258NP_651531.1 JHBP 13..255 CDD:284096 64/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.