DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5945 and CG17279

DIOPT Version :9

Sequence 1:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:281 Identity:56/281 - (19%)
Similarity:109/281 - (38%) Gaps:74/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSLLALGCS--AAPTDKNYFADLPKCSTEEDQLGE--CVKQLFNTLTPRLKDGNPEL-------- 60
            :.|:...|.  .||:......::.||     :.|:  |:.:....:......|.|.:        
  Fly     1 MRLIVFVCCLWMAPSLGQLPPEIEKC-----RAGDSICIAETVTRILRLYPKGLPSIGLVALDSI 60

  Fly    61 --------RIEP-----YEPLHLNRTSFQYSSGTVNGRITVRNAKIYGFSSN--RAKEVS----- 105
                    |:||     ::....|.|...::..||.      .||  ||.::  |..|:|     
  Fly    61 GFEDVVVSRLEPDGSSTFDLKFPNLTVIGFADSTVT------EAK--GFDADLPRVLELSGWIPL 117

  Fly   106 VKLNGD-KVKLRLVTQMPKLNIVGSYKADMQVNQLQLKPKGEFNVTLLDVEAITVTDGEVYEKDG 169
            :||||. :::..|:| ||   |.|..:|.:::.:.:::.|    |.:|          |....||
  Fly   118 LKLNGTYEMRGSLLT-MP---IHGKGQAKVEIRECRVRCK----VRVL----------EDLRDDG 164

  Fly   170 HRFFRLKNIDSKPKIKDLVIKANGIFADPELDKIALNVANQYWRDIY-----GIMLPETRQFWQP 229
            ..:..:..:.....::.:.:....:|.:||:......|||..|.:|:     || .....|..:.
  Fly   165 KLYAGISKVKCLLDVQGMHLNLENLFNNPEMSDAMNVVANTKWLEIWHNLRRGI-TSAVDQLVES 228

  Fly   230 LMLRMFNEAFELVPIDQFLKE 250
            ::.|:.|:    :|.|...::
  Fly   229 ILQRVANK----LPYDDLYRD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 52/262 (20%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 55/273 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.