DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5945 and CG7079

DIOPT Version :9

Sequence 1:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:253 Identity:53/253 - (20%)
Similarity:104/253 - (41%) Gaps:22/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YCTIGLLSLLALGCSAAPTDKNYFADLPKCSTEEDQLGECVKQLFNTLTPRLKDGNPELRIEPYE 66
            |..|.:.....|.|...|      |.:.||...:   |:|:.:..|.|......|.||:.::|:.
  Fly     6 YVIITIQLFGGLQCQKLP------AKVKKCHFGD---GKCLVESANALLRDFPKGIPEVDLKPFN 61

  Fly    67 PLHLNRTSFQYSSGTVNGR---ITVRNAKIYGFSSNRAKEVSVKLNGDK----VKLRLVTQMPKL 124
            .|.: |.....:...|.|.   ..:.|...|||.:....|:.   ..||    .|:.:..::|:|
  Fly    62 VLSV-RDWLLVNDSQVGGAWYYFNLINQINYGFENTTITEIR---GFDKDPTTTKIEIHGKIPRL 122

  Fly   125 NIVGSYKADMQVNQ-LQLKPKGEFNVTLLDVEAITVTDGEVYEKDGHRFFRLKNIDSKPKIKDLV 188
            ...|.|.|..::.. :.:..:|......|:.:.:......|..::..|:.::..:....::...:
  Fly   123 VYKGDYVAKGRMLWFVDIHSQGTSESDFLNFQFVLTLKVRVEYRNNKRYLKIYELVPNIRLDRWI 187

  Fly   189 IKANGIFADPELDKIAL-NVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPID 245
            :..:..|.|.|...||: |:.|:.|.:.:..:.|...:.::.:.|.:|.:.||.||.|
  Fly   188 MWLDNFFPDNEDLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 48/233 (21%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 49/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.