DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5945 and CG10407

DIOPT Version :9

Sequence 1:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster


Alignment Length:248 Identity:68/248 - (27%)
Similarity:108/248 - (43%) Gaps:29/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YCTIGLLSLLALG-------CSAAPTDKNYFAD-LPK----CSTEEDQLGECVKQLFNTLTPRLK 54
            |...||  ||.||       .:|.|..|.  || ||.    |......|..||::.:..|.|||.
  Fly     4 YFLTGL--LLVLGVVLHIDWTTAKPPAKK--ADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLM 64

  Fly    55 DGNPELRIEPYEPLHLNRTSFQYSSGTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKLRLVT 119
            :|.|||.|...|||.:.:......||.:......||.|:.|.|.:...|  ::|...|:|..|..
  Fly    65 EGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSVYRNVKVTGISKHTVNE--LRLEPSKLKFILSL 127

  Fly   120 QMPKLNIVGSYKADM----QVNQLQLKPKGEFNVTLLDVEAITVTDGEVYEKDGHRFFRLKNIDS 180
            ..|||::...|...:    ::..:.|...|...|.|:::...|...|:.|:|:|..|.::..:..
  Fly   128 TFPKLHMESDYSIKVSREGKIMMMPLLGDGHCKVDLVNITMRTELIGQEYKKNGANFLKINTVKV 192

  Fly   181 KPKIKDLVIKANGIFADPELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLR 233
            |.::.|:.|..:.:|..   ||...:..|::..:.:..:..|.|    |||.:
  Fly   193 KYELSDVHIHLDNLFNG---DKALGDRMNEFLNENWKALAEEVR----PLMTK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 59/221 (27%)
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 59/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.