DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5945 and CG14661

DIOPT Version :9

Sequence 1:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster


Alignment Length:210 Identity:48/210 - (22%)
Similarity:83/210 - (39%) Gaps:41/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IGLLSLLALGCSAAPTDKNYFADLPKCSTEEDQLGECVKQLFNTLTPRLKDGNPELRIEPYEPLH 69
            :..|.:..:.|.:|....:|   :..|...:.:|.:|:|...:.|.|.|..|..||.:.|.|||:
  Fly     7 VASLLICFVACISAGNMPDY---IQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLY 68

  Fly    70 LNRTSFQYSSGTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKLRLVTQ---------MPKLN 125
            :...|.  ..|:....:..:...|.|.|           |.:..|||..||         :|.|:
  Fly    69 IGDLSI--LDGSAGLTVKAKKLNILGAS-----------NFEITKLRASTQNRRFDFELILPHLH 120

  Fly   126 IVGSYKADMQVNQLQLKPKGEF--NVT--------------LLDVEAITVTDGEVYEKDGHRFFR 174
            ..|.|:.:..:..|.:|..|.|  |.|              :.|:|.:.|.:..:..:.|....:
  Fly   121 GDGLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLK 185

  Fly   175 LKNIDSKPKIKDLVI 189
            |:|:.:..|:...||
  Fly   186 LENLFNGDKVLGDVI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 45/193 (23%)
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 48/207 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.