DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5945 and CG33680

DIOPT Version :9

Sequence 1:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster


Alignment Length:248 Identity:47/248 - (18%)
Similarity:88/248 - (35%) Gaps:77/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LGECVKQLFN------------TLTPRLKDGNPELRIEPYEPLHLNRTSFQYSSGTVNGRITVRN 90
            :|.||..:||            |:||..::          ||| |.|.       .:|....:|.
  Fly    12 VGNCVIVVFNFLFPINIFLLAFTITPCARN----------EPL-LERC-------IINAAYQIRP 58

  Fly    91 AKIY-----GFSSNRAKEVSVKLNGDKVKLRLVTQMPKL---------NIVGSYKADMQVNQLQL 141
            ..::     ||.::..:.:|:    |.::|:|.:|...:         |..|.|...:.:....:
  Fly    59 LLVHGNLGDGFPTSPLEPLSL----DNIELKLSSQFQAVFKDLEANGGNYTGKYSLHLNLLLPDI 119

  Fly   142 KPKGEFNVTLLDVEAITVTDGEVYEKDGHRFFRLKNIDSKPKIKDLVIKANGIFA-DPELDKIAL 205
            |.||.......:.:|.....|..|.::|..:.:...:.:....||..:|...:|: |..|..:..
  Fly   120 KGKGNMQGYCENAKAFVKIRGSRYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGN 184

  Fly   206 NVANQ----YWRDI-----YGI-------------------MLPETRQFWQPL 230
            ::.|.    |.:||     :|:                   |.|..:.|..|:
  Fly   185 SLINNNQELYLKDIAPSLEHGLSKHFLDVADKILASATFDEMFPPGKTFVSPI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 47/248 (19%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 39/218 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.