DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5945 and dyw

DIOPT Version :9

Sequence 1:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster


Alignment Length:258 Identity:64/258 - (24%)
Similarity:115/258 - (44%) Gaps:23/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IGLLSLLALGCSAAPTDKNYFADLPKCSTEEDQLGECVKQLFNTLTPRLKDGNPELRIEPYEPLH 69
            :||||.::....|:   :.:.:.|.:|..:::   .|:.....|.....|:|.||.::...||:.
  Fly    13 VGLLSWVSCRVDAS---EGFPSPLKRCKLQDE---SCLLAQAQTFFQAFKNGIPERQVAALEPIA 71

  Fly    70 LNRTSFQYSSG---TVNGRITVRNAKIYGFSSNRAKEVSVK-LNG------DKVKLRLVTQMPKL 124
            |. |.|..|.|   ::..::|:.:||:|    |.|..:.|| |.|      ..:||.|:...|:|
  Fly    72 LG-TMFIESGGHSESIKFKLTMSDAKLY----NLANSMMVKSLKGFTKDLTRPLKLTLLLDNPEL 131

  Fly   125 NIVGSYKADMQVNQLQLKPKGEFNVTLLDVEA-ITVTDGEVYEKDGHRFFRLKNIDSKPKIKDLV 188
            .:...|..|.::..|.:..||:..:.|.||.. :.:|...|...|||.:..:.:..:..|||...
  Fly   132 EVRAKYDVDGKLLILPIVSKGDLTIRLNDVHTKVWITAEPVKRSDGHTYLNITDYKTATKIKGGH 196

  Fly   189 IKANGIFAD-PELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPIDQFLKE 250
            ...:.:|.| .||....|.|.||.|..:...:.|:..:........:....:..:|.|:|.::
  Fly   197 FDLSNLFNDNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFFEK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 59/238 (25%)
dywNP_570016.1 JHBP 29..258 CDD:214779 59/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.