DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5867 and CG34316

DIOPT Version :9

Sequence 1:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster


Alignment Length:200 Identity:45/200 - (22%)
Similarity:79/200 - (39%) Gaps:47/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LQQITPRMKYGISELNIPPLDPFEMGKSSYSYTSG-LLQGRISMKNVVIHGLSE----------- 109
            ||:...||.:.|..|.:|.|||.::|.:.....:. |:....|:.|..:||||:           
  Fly    36 LQEFRMRMCHPIPNLGLPALDPLQLGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPV 100

  Fly   110 -GIVDKVNFRLKDGRVRMEILSHVPQMFVEGLYKADIKL-NDLKLNPKGAFNITMTD----VAMR 168
             |:.:.:|..|             |..:.:.||.|...| ..|.|...|....::|:    ::.|
  Fly   101 PGLKNTINVTL-------------PLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSILISFR 152

  Fly   169 ARPIGELYERDGHTYLRLTKLETEPKVGDLKFYANGLVPDPVLNDVILDFINQYWRQLYQAMLPE 233
            .|.:..         |.::.|:.|.::|.|....:.|:.:..:||.|...:|:...:|..     
  Fly   153 LRSVSP---------LAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGVELLG----- 203

  Fly   234 TLDTW 238
              |.|
  Fly   204 --DVW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 44/199 (22%)
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 44/199 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.