DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5867 and CG11854

DIOPT Version :9

Sequence 1:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster


Alignment Length:263 Identity:65/263 - (24%)
Similarity:120/263 - (45%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VALILMAGLCLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPR-MKYGISEL 71
            :||:|:.| |.:.        :....:.|..|..|...|   .:|::..:..:... .|.||.||
  Fly     5 LALVLLFG-CAST--------YGHASDFPSGIERCAIMD---EQCLEDRVNFVLRNYAKSGIKEL 57

  Fly    72 NIPPLDP-----FEMGKSSYSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRVRMEILSH 131
            .:.||||     |::|::.:|    .:...:|...:.|.||.:|:..:|:...:|....:|::..
  Fly    58 GLIPLDPLHVKKFKIGRNPHS----PVNIDLSFHEMDILGLHQGVAKRVSGFTRDLSRSIELVME 118

  Fly   132 VPQMFVEGLYKADIKLNDLKLNPKGAFNITMTDVAMRAR-PIGELYERDGHTYLRL--TKLETEP 193
            ||::.|.|.|..|.::..|.:...|..:|.:|...:||: .:..:.:.|..||..:  .|:|.:|
  Fly   119 VPEIGVRGPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDP 183

  Fly   194 K--VGDLKFYANGLVPDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTND-FFAALPF 255
            .  ...|:...||   ...|::.:...||:.|:.::..:.|...:.: .||.||..| .|..||.
  Fly   184 SHVTYQLENLFNG---QKDLSENMHALINENWKDIFNELKPGIGEAF-GLIAKSVVDRIFGKLPL 244

  Fly   256 DML 258
            :.|
  Fly   245 EQL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 60/237 (25%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 60/238 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.