DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5867 and to

DIOPT Version :9

Sequence 1:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster


Alignment Length:263 Identity:59/263 - (22%)
Similarity:102/263 - (38%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALILMAGLCLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQI-TPRMKYGISELN 72
            |:.....|||...::         .:.|.|...|:.||   .|||.:....: :.....|...||
  Fly     3 AIAFAVVLCLLVSVD---------AKFPEDPKPCKYGD---GECIMKLCNTLFSENSAEGDPGLN 55

  Fly    73 IPPLDPFEM-------GKSS------YSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRV 124
            :..|||.::       |:||      .::|..||.|....:.|.:.|....:..|...::     
  Fly    56 LMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKI----- 115

  Fly   125 RMEILSHVPQMF-VEGLYKADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTK 188
                   |.:.| :.|.|....|:..|.::..|..|:||.:|.......|:...::|.|||.:|.
  Fly   116 -------VTKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTD 173

  Fly   189 LETEPKVGDLKFYANGLV-PDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAA 252
            |:...|.....::.:.|. .|..|.|.:..|:|:....:|:........::..|.|......|:.
  Fly   174 LKITMKPESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSK 238

  Fly   253 LPF 255
            ||:
  Fly   239 LPY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 55/238 (23%)
toNP_001287525.1 JHBP 5..245 CDD:284096 58/261 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.