DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5867 and CG17279

DIOPT Version :9

Sequence 1:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:233 Identity:50/233 - (21%)
Similarity:99/233 - (42%) Gaps:16/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EIPGDIPTCREGDINISECIKQGLQQITPRMKYGISELNIPPLDP--FEMGKSSYSYTSGLLQGR 96
            ::|.:|..||.||   |.||.:.:.:|......|:..:.:..||.  ||....|.....|.....
  Fly    18 QLPPEIEKCRAGD---SICIAETVTRILRLYPKGLPSIGLVALDSIGFEDVVVSRLEPDGSSTFD 79

  Fly    97 ISMKNVVIHGLSEGIVDKV-NFRLKDGRVRMEILSHVPQMFVEGLYKADIKLNDLKLNPKGAFNI 160
            :...|:.:.|.::..|.:. .|.....|| :|:...:|.:.:.|.|:....|..:.::.||...:
  Fly    80 LKFPNLTVIGFADSTVTEAKGFDADLPRV-LELSGWIPLLKLNGTYEMRGSLLTMPIHGKGQAKV 143

  Fly   161 TMTD--VAMRARPIGELYERDGHTYLRLTKLETEPKVGDLKFYANGLVPDPVLNDVILDFINQYW 223
            .:.:  |..:.|.:.:|.: ||..|..::|::....|..:......|..:|.::|.:....|..|
  Fly   144 EIRECRVRCKVRVLEDLRD-DGKLYAGISKVKCLLDVQGMHLNLENLFNNPEMSDAMNVVANTKW 207

  Fly   224 RQLYQAM---LPETLDTWQPLILKSTNDFFAALPFDML 258
            .:::..:   :...:|.....||:...:   .||:|.|
  Fly   208 LEIWHNLRRGITSAVDQLVESILQRVAN---KLPYDDL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 50/233 (21%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 50/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.