DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5867 and CG7079

DIOPT Version :9

Sequence 1:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:274 Identity:47/274 - (17%)
Similarity:108/274 - (39%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVALILMAGL-CLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPRMKYGISE 70
            ::.:.|..|| |               :::|..:..|..||   .:|:.:....:......||.|
  Fly     8 IITIQLFGGLQC---------------QKLPAKVKKCHFGD---GKCLVESANALLRDFPKGIPE 54

  Fly    71 LNIPP-----------LDPFEMGKSSYSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKD-GR 123
            :::.|           ::..::|.:.|.:         ::.|.:.:|.....:.::....|| ..
  Fly    55 VDLKPFNVLSVRDWLLVNDSQVGGAWYYF---------NLINQINYGFENTTITEIRGFDKDPTT 110

  Fly   124 VRMEILSHVPQMFVEGLYKADIK-LNDLKLNPKGA-------FNITMTDVAMRARPIGELYERDG 180
            .::||...:|::..:|.|.|..: |..:.::.:|.       |...:|   ::.|    :..|:.
  Fly   111 TKIEIHGKIPRLVYKGDYVAKGRMLWFVDIHSQGTSESDFLNFQFVLT---LKVR----VEYRNN 168

  Fly   181 HTYLRLTKLETEPKVGDLKFYANGLVPD-PVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILK 244
            ..||::.:|....::.....:.:...|| ..|...:.:..|:.|.:.:..:.|..|..::.:.|.
  Fly   169 KRYLKIYELVPNIRLDRWIMWLDNFFPDNEDLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLS 233

  Fly   245 STNDFFAALPFDML 258
            ...|.|..:|:|.|
  Fly   234 LFEDLFEKVPYDDL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 43/246 (17%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 43/247 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.