DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5867 and CG31189

DIOPT Version :9

Sequence 1:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster


Alignment Length:263 Identity:54/263 - (20%)
Similarity:98/263 - (37%) Gaps:51/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILMAGLCLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPRMKYGISELNIP 74
            ||.:..||....:.:...      .:|.|:..|..||   |.|:.:.:..:......||.|:.:|
  Fly     4 LISLTFLCWCIPVMISGA------SLPEDVEKCHFGD---STCLVRSINALIKHYPKGIPEIGLP 59

  Fly    75 PLDPFEMGKS--SYSYTSGLLQGRISMKNVVIHGLSEGIVDKV-NFRLKDGRVRMEILSHVPQMF 136
            |||.:....|  ..|.:.|.:.....|::.|..|.:...:..| .|..:..:.::.:...:|::.
  Fly    60 PLDAYNFPDSVIMESPSRGPIWMDFRMRDNVNKGFNNATITHVEGFLYEPNQKQIVLKVRLPRLV 124

  Fly   137 VEGLYKADIKLNDLKLNPKGA-------FNITMTDVAMRARPIGELYE-RDGHTYLRLTKLETEP 193
            .|..|....::.....|..|.       |.||:|        |..|.| |:...||::..|....
  Fly   125 HEATYDMSGRVLLFFFNTTGRLISDFQNFRITLT--------IKALVEYRNDKRYLKIYNLVPSL 181

  Fly   194 KVGDLKFYANGLVPDPVLNDVILDFIN--------QYWRQLYQAMLPETLDTWQPLILKSTNDFF 250
            .:.....:.:||..:   |..:..|:|        ::|..|            ||.::|:..:.|
  Fly   182 DLDRWIIWLDGLYKE---NTDVTIFMNKLFNENWVEFWNDL------------QPGLVKAFTNAF 231

  Fly   251 AAL 253
            ..|
  Fly   232 TVL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 50/239 (21%)
CG31189NP_732580.3 JHBP 9..249 CDD:284096 52/258 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.