DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5867 and CG10407

DIOPT Version :9

Sequence 1:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster


Alignment Length:266 Identity:58/266 - (21%)
Similarity:131/266 - (49%) Gaps:12/266 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRIFGVVALILMAGLCLAAE--IELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPR 63
            |.:.| :..|:|:.|:.|..:  ...||.  |...::|..:..|.....::..|:::..:::.||
  Fly     1 MNQYF-LTGLLLVLGVVLHIDWTTAKPPA--KKADQLPSFLKVCHRNAPDLDTCVRESYEELRPR 62

  Fly    64 MKYGISELNIPPLDPFEMGKSSYSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRVRMEI 128
            :..||.||.||.::|..:.:......||.:......:||.:.|:|:..|:::  ||:..:::..:
  Fly    63 LMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSVYRNVKVTGISKHTVNEL--RLEPSKLKFIL 125

  Fly   129 LSHVPQMFVEGLYKADI----KLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTKL 189
            ....|::.:|..|...:    |:..:.|...|...:.:.::.||...||:.|:::|..:|::..:
  Fly   126 SLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCKVDLVNITMRTELIGQEYKKNGANFLKINTV 190

  Fly   190 ETEPKVGDLKFYANGLV-PDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAAL 253
            :.:.::.|:..:.:.|. .|..|.|.:.:|:|:.|:.|.:.:.|........::..|.:..||:.
  Fly   191 KVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASF 255

  Fly   254 PFDMLV 259
            .:|.|:
  Fly   256 SYDDLL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 49/231 (21%)
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 50/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.