DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5867 and dyw

DIOPT Version :9

Sequence 1:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster


Alignment Length:234 Identity:57/234 - (24%)
Similarity:98/234 - (41%) Gaps:12/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PGDIPTCREGDINISECIKQGLQQITPRMKYGISELNIPPLDPFEMGKSSYSYTSG---LLQGRI 97
            |..:..|:..|   ..|:....|......|.||.|..:..|:|..:| :.:..:.|   .::.::
  Fly    30 PSPLKRCKLQD---ESCLLAQAQTFFQAFKNGIPERQVAALEPIALG-TMFIESGGHSESIKFKL 90

  Fly    98 SMKNVVIHGLSEG-IVDKVNFRLKD--GRVRMEILSHVPQMFVEGLYKADIKLNDLKLNPKGAFN 159
            :|.:..::.|:.. :|..:....||  ..:::.:|...|::.|...|..|.||..|.:..||...
  Fly    91 TMSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAKYDVDGKLLILPIVSKGDLT 155

  Fly   160 ITMTDVAMRARPIGELYER-DGHTYLRLTKLETEPKVGDLKFYANGLVPD-PVLNDVILDFINQY 222
            |.:.||..:.....|..:| ||||||.:|..:|..|:....|..:.|..| ..|.|..|..:||.
  Fly   156 IRLNDVHTKVWITAEPVKRSDGHTYLNITDYKTATKIKGGHFDLSNLFNDNKELRDSTLKVLNQE 220

  Fly   223 WRQLYQAMLPETLDTWQPLILKSTNDFFAALPFDMLVTK 261
            |..|...:.|:..:.............:|.:|:|....|
  Fly   221 WSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFFEK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 56/231 (24%)
dywNP_570016.1 JHBP 29..258 CDD:214779 56/231 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.