DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and bZIP19

DIOPT Version :9

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001320139.1 Gene:bZIP19 / 829656 AraportID:AT4G35040 Length:261 Species:Arabidopsis thaliana


Alignment Length:50 Identity:14/50 - (28%)
Similarity:20/50 - (40%) Gaps:5/50 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 KDQERRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARV 161
            |.::|...|..|.|..|.|||.....:|.:.     ..|:...|.|..|:
plant    91 KGEKRPLGNREAVRKYREKKKAKAASLEDEV-----ARLRAVNQQLVKRL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
bZIP19NP_001320139.1 BRLZ 91..152 CDD:197664 14/49 (29%)
coiled coil 93..146 CDD:269834 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.