DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and BZIP24

DIOPT Version :9

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_190764.2 Gene:BZIP24 / 824359 AraportID:AT3G51960 Length:228 Species:Arabidopsis thaliana


Alignment Length:133 Identity:30/133 - (22%)
Similarity:48/133 - (36%) Gaps:35/133 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DAANQSVSLGFSDQDADFPPLPKRRRLGSSSSSVSYQSASPIITEAIQDIFKYHVNMVRKFPKKE 108
            |.....|:.|.|...:..||       |...:|.|:            ..|..|.:::....::|
plant    45 DKDQDRVTRGCSHTHSCNPP-------GPEDASHSH------------TCFHAHTHLIISQDQQE 90

  Fly   109 RSPKDQERRNK---NTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLV 170
            ....|...:.:   |..|.|..|.|||.....:|       ||.:::  |||..:    .|::|.
plant    91 NDHSDSSNKKRLCGNREAVRKYREKKKARTAYLE-------DEVMRL--QSLNEQ----FLRKLQ 142

  Fly   171 KQE 173
            .||
plant   143 SQE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
BZIP24NP_190764.2 coiled coil 99..146 CDD:269834 17/60 (28%)
bZIP_2 104..145 CDD:400181 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.