DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and cebpb

DIOPT Version :9

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001030293.1 Gene:cebpb / 619595 XenbaseID:XB-GENE-479779 Length:145 Species:Xenopus tropicalis


Alignment Length:65 Identity:20/65 - (30%)
Similarity:37/65 - (56%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQEDHPLVSS 180
            ||.:|.||.|.||.|.|..:::.:.:..|.|.|:.::.::..:....|:.|:.|.||...||:::
 Frog    77 RRERNNIAVRKSRDKAKIRNMETQHKVLELSAENERLQKRVEQLSRELSTLRNLFKQLPEPLLAA 141

  Fly   181  180
             Frog   142  141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
cebpbNP_001030293.1 bZIP_CEBPB 67..134 CDD:269860 17/56 (30%)
coiled coil 71..132 CDD:269860 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.