DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and cebpa

DIOPT Version :9

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001011044.1 Gene:cebpa / 496454 XenbaseID:XB-GENE-853397 Length:297 Species:Xenopus tropicalis


Alignment Length:136 Identity:37/136 - (27%)
Similarity:58/136 - (42%) Gaps:27/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PPLP----------KRRRLGSSSSSVSYQSASPIITEAIQDIFKYHVNMVRKFPKKERSPKDQER 116
            ||.|          ....|.||    |.:|.||  :.:|......:....:|:..|. |.:.:.|
 Frog   170 PPTPVPSPHHHPTHHHHHLQSS----SLKSVSP--SSSISSSSSENRGKSKKWVDKS-SSEYRVR 227

  Fly   117 RNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQEDHPLVSSR 181
            |.:|.||.|.||.|.|..:.:.:.:..|.|.|:.|     ||.||     :||.::.:......|
 Frog   228 RERNNIAVRKSRDKAKMRNAETQHKVIELSTENDK-----LRKRV-----EQLSRELETLRGIFR 282

  Fly   182 RVPEEN 187
            ::||.:
 Frog   283 QLPESS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
cebpaNP_001011044.1 bZIP_CEBPB 214..284 CDD:269860 24/80 (30%)
coiled coil 221..282 CDD:269860 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.