DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and slbo

DIOPT Version :9

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster


Alignment Length:83 Identity:20/83 - (24%)
Similarity:33/83 - (39%) Gaps:19/83 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QERRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQ--------SLRARVY---LNH-- 165
            :.||.:|.||.|.||.|.|....::|::.|....|...:..|        .|..::|   :||  
  Fly   367 RRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQLHKQIYMQLMNHAN 431

  Fly   166 ------LKQLVKQEDHPL 177
                  .:..:...:|.|
  Fly   432 PEVSRVCRSFLNTNEHSL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 15/52 (29%)
coiled coil 363..420 CDD:269841 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.