DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and CG16815

DIOPT Version :9

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_609622.2 Gene:CG16815 / 34725 FlyBaseID:FBgn0032491 Length:192 Species:Drosophila melanogaster


Alignment Length:177 Identity:51/177 - (28%)
Similarity:80/177 - (45%) Gaps:35/177 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEHHQIYRHKKFDMGRKIEKCDLQLKEELISRSGTPCTSRSPFDAANQSVSLGF--------SDQ 57
            ||:...|.||||.:.::..:.|.. ||....:|..|...|..        :.||        .:|
  Fly     1 MENSSSYTHKKFAVSKRKREVDHD-KENQTQQSEQPIFKRRQ--------TQGFFRPWLDNEQNQ 56

  Fly    58 DADFPPLPKRRRLGSSSSSVSYQSASPIITEAIQDIFKYHVNMVRKF-PKKERSPKDQERRNKNT 121
            .|:.......:..|..||                 :.:|..||||:. ..::||||:|.||::||
  Fly    57 QAEKETSTAAKPSGPGSS-----------------VSQYRANMVRRSNTNRQRSPKEQMRRDRNT 104

  Fly   122 IACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQ 168
            :||.:|||.|:..:.|:.|||::....|..:.||.:|..:|..|:.|
  Fly   105 LACLLSRRAKQAQEEQVGQQYEQYRSHHAAMLEQQVRLSLYYRHILQ 151



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C048
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.