DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mabi and Cebpd

DIOPT Version :9

Sequence 1:	NP_609624.1	Gene:	Mabi / 34727	FlyBaseID:	FBgn0032493	Length:	206	Species:	Drosophila melanogaster
Sequence 2:	NP_037286.1	Gene:	Cebpd / 25695	RGDID:	2328	Length:	268	Species:	Rattus norvegicus

Alignment Length:	67	Identity:	22/67 - (32%)
Similarity:	38/67 - (56%)	Gaps:	0/67 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   110 SPKDQERRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQED 174
            ||:.::||.:|.||.|.||.|.|..:.:::|:..|.|.|:.|:.::..:....|..|:|..|:..
  Rat   191 SPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLASLRQFFKELP 255

  Fly   175 HP 176
            .|
  Rat   256 SP 257

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mabi	NP_609624.1	None
Cebpd	NP_037286.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..50
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	98..132
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	152..223		13/31 (42%)
		bZIP_CEBPD	188..252	CDD:269862	20/60 (33%)
		coiled coil	191..249	CDD:269862	19/57 (33%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	195..222		10/26 (38%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	226..254		7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23334
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100