DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and Cebpe

DIOPT Version :10

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_058791.1 Gene:Cebpe / 25410 RGDID:2329 Length:281 Species:Rattus norvegicus


Alignment Length:70 Identity:23/70 - (32%)
Similarity:35/70 - (50%) Gaps:10/70 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQEDHPLVSS 180
            ||.:|.||.|.||.|.|...::.:|:..|...|:     :.||:||     .||.::.|......
  Rat   210 RRERNNIAVRKSRDKAKRRIMETQQKVLEYMAEN-----ERLRSRV-----DQLTQELDTLRNLF 264

  Fly   181 RRVPE 185
            |::||
  Rat   265 RQIPE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
CebpeNP_058791.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
bZIP_CEBPE 202..262 CDD:269863 20/61 (33%)
coiled coil 204..262 CDD:269863 20/61 (33%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..245 13/39 (33%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 246..267 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.