DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and Cebpa

DIOPT Version :9

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001274506.1 Gene:Cebpa / 24252 RGDID:2326 Length:395 Species:Rattus norvegicus


Alignment Length:72 Identity:22/72 - (30%)
Similarity:37/72 - (51%) Gaps:10/72 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQEDHPLVSS 180
            ||.:|.||.|.||.|.|..:::.:|:..|.:.::     ..||.||     :||.::.|......
  Rat   325 RRERNNIAVRKSRDKAKQRNVETQQKVLELTSDN-----DRLRKRV-----EQLSRELDTLRGIF 379

  Fly   181 RRVPEEN 187
            |::||.:
  Rat   380 RQLPESS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
CebpaNP_001274506.1 bZIP_CEBPA 317..377 CDD:269859 19/61 (31%)
coiled coil 319..377 CDD:269859 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.