powered by:
Protein Alignment Mabi and Cebpa
DIOPT Version :9
Sequence 1: | NP_609624.1 |
Gene: | Mabi / 34727 |
FlyBaseID: | FBgn0032493 |
Length: | 206 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001274506.1 |
Gene: | Cebpa / 24252 |
RGDID: | 2326 |
Length: | 395 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 37/72 - (51%) |
Gaps: | 10/72 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 116 RRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQEDHPLVSS 180
||.:|.||.|.||.|.|..:::.:|:..|.:.:: ..||.|| :||.::.|......
Rat 325 RRERNNIAVRKSRDKAKQRNVETQQKVLELTSDN-----DRLRKRV-----EQLSRELDTLRGIF 379
Fly 181 RRVPEEN 187
|::||.:
Rat 380 RQLPESS 386
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23334 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.