DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and cebpd

DIOPT Version :9

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_571962.1 Gene:cebpd / 140817 ZFINID:ZDB-GENE-020111-4 Length:280 Species:Danio rerio


Alignment Length:76 Identity:23/76 - (30%)
Similarity:39/76 - (51%) Gaps:8/76 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PKKER--------SPKDQERRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARV 161
            |.||:        ||:.::||.:|.||.|.||.|.|..:|.::|:..|...|:.::.:...:...
Zfish   188 PGKEKGKKNVDRHSPEYRQRRERNNIAVRKSRDKAKQRNLDMQQKMIELGAENERLHKTIDQLTR 252

  Fly   162 YLNHLKQLVKQ 172
            .|:.|:...||
Zfish   253 ELSSLRNFFKQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
cebpdNP_571962.1 bZIP 198..262 CDD:304365 18/63 (29%)
coiled coil 204..255 CDD:269834 14/50 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.