DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and cebpb

DIOPT Version :10

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_571959.2 Gene:cebpb / 140814 ZFINID:ZDB-GENE-020111-3 Length:280 Species:Danio rerio


Alignment Length:67 Identity:22/67 - (32%)
Similarity:34/67 - (50%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KERSPKD----QERRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEH---LKIAEQSLRARVYLN 164
            |:|..||    ::||.:|.:|.|.||.|.|..:|:.:.:..|.:.|:   .|..||..|....|.
Zfish   207 KKRLDKDSDEYRQRRERNNLAVRKSRDKAKMRNLETQHKVLELAAENDRLQKRVEQLSRELATLR 271

  Fly   165 HL 166
            :|
Zfish   272 NL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
cebpbNP_571959.2 bZIP_CEBPB 207..277 CDD:269860 22/67 (33%)
coiled coil 214..275 CDD:269860 18/60 (30%)

Return to query results.
Submit another query.