DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and Cebpd

DIOPT Version :9

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_031705.3 Gene:Cebpd / 12609 MGIID:103573 Length:268 Species:Mus musculus


Alignment Length:67 Identity:22/67 - (32%)
Similarity:38/67 - (56%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SPKDQERRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQED 174
            ||:.::||.:|.||.|.||.|.|..:.:::|:..|.|.|:.|:.::..:....|..|:|..|:..
Mouse   191 SPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKKLP 255

  Fly   175 HP 176
            .|
Mouse   256 SP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
CebpdNP_031705.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..132
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..219 12/27 (44%)
bZIP_CEBPD 188..252 CDD:269862 20/60 (33%)
coiled coil 191..249 CDD:269862 19/57 (33%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 10/26 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.