DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and cebp1

DIOPT Version :9

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_571912.1 Gene:cebp1 / 114453 ZFINID:ZDB-GENE-010611-1 Length:169 Species:Danio rerio


Alignment Length:163 Identity:36/163 - (22%)
Similarity:76/163 - (46%) Gaps:15/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ISRSGTPCTSRSPFDAANQSVSLGFS-DQDADFPPLPKRRRLGSSSSSV--SYQSASPIITEAIQ 91
            :..:.:..::::|.|:|..:.::.|: ..:.....||....|.:.:::.  |.|.:|....:..|
Zfish    10 VHEASSDSSAQTPMDSALYTQTISFTKSPEVMMGYLPYSSCLNNPNTNTERSVQQSSAHTQDFAQ 74

  Fly    92 DIFKYHVNMVRKFPKKERSPKD----QERRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKI 152
            .:.....:.:|...:|....||    ::||.:|.||.|.||.|.: ..:|:.||      ..|::
Zfish    75 FLEPPPASALRLCAQKRGVSKDSAEYRQRRERNNIAVRKSRDKAR-RRIQMTQQ------RALQL 132

  Fly   153 AEQSLRARVYLNHLKQLVKQEDHPLVSSRRVPE 185
            .:::.|.:|::..|...|:...|.| |.|.:.:
Zfish   133 QDENHRLQVHIQRLLHEVEALRHYL-SQRHLQD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
cebp1NP_571912.1 bZIP_CEBP 96..155 CDD:269841 18/65 (28%)
coiled coil 97..155 CDD:269841 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.