DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and Cebpe

DIOPT Version :10

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_997014.1 Gene:Cebpe / 110794 MGIID:103572 Length:281 Species:Mus musculus


Alignment Length:70 Identity:22/70 - (31%)
Similarity:34/70 - (48%) Gaps:10/70 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQEDHPLVSS 180
            ||.:|.||.|.||.|.|...::.:|:..|...|:     :.||     |.:.||.::.|......
Mouse   210 RRERNNIAVRKSRDKAKRRIMETQQKVLEYMAEN-----ERLR-----NRVDQLTQELDTLRNLF 264

  Fly   181 RRVPE 185
            |::||
Mouse   265 RQIPE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
CebpeNP_997014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
bZIP_CEBPE 202..262 CDD:269863 19/61 (31%)
coiled coil 204..262 CDD:269863 19/61 (31%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..245 13/39 (33%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 246..267 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.