DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mabi and CEBPE

DIOPT Version :10

Sequence 1:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001796.2 Gene:CEBPE / 1053 HGNCID:1836 Length:281 Species:Homo sapiens


Alignment Length:70 Identity:24/70 - (34%)
Similarity:36/70 - (51%) Gaps:10/70 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQEDHPLVSS 180
            ||.:|.||.|.||.|.|...|:.:|:..|...|:     :.||:||     :||.::.|......
Human   210 RRERNNIAVRKSRDKAKRRILETQQKVLEYMAEN-----ERLRSRV-----EQLTQELDTLRNLF 264

  Fly   181 RRVPE 185
            |::||
Human   265 RQIPE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MabiNP_609624.1 None
CEBPENP_001796.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PHA03247 <62..192 CDD:223021
bZIP_CEBPE 202..262 CDD:269863 21/61 (34%)
coiled coil 204..262 CDD:269863 21/61 (34%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..228 10/17 (59%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 230..237 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.