DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mabi and CEBPE

DIOPT Version :9

Sequence 1:	NP_609624.1	Gene:	Mabi / 34727	FlyBaseID:	FBgn0032493	Length:	206	Species:	Drosophila melanogaster
Sequence 2:	NP_001796.2	Gene:	CEBPE / 1053	HGNCID:	1836	Length:	281	Species:	Homo sapiens

Alignment Length:	70	Identity:	24/70 - (34%)
Similarity:	36/70 - (51%)	Gaps:	10/70 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   116 RRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQEDHPLVSS 180
            ||.:|.||.|.||.|.|...|:.:|:..|...|:     :.||:||     :||.::.|......
Human   210 RRERNNIAVRKSRDKAKRRILETQQKVLEYMAEN-----ERLRSRV-----EQLTQELDTLRNLF 264

  Fly   181 RRVPE 185
            |::||
Human   265 RQIPE 269

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mabi	NP_609624.1	None
CEBPE	NP_001796.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..30
		PHA03247	<62..192	CDD:223021
		bZIP_CEBPE	202..262	CDD:269863	21/61 (34%)
		coiled coil	207..258	CDD:269863	20/57 (35%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	208..228		10/17 (59%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	230..237		2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23334
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100