DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and PUP3

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_011020.3 Gene:PUP3 / 856830 SGDID:S000000896 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:223 Identity:50/223 - (22%)
Similarity:81/223 - (36%) Gaps:49/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GAATVGLKGTDYAVLAALCRTSKDTNTLQRKIMPV--DDHVGMSIAGLTADARVVCQYMRTECMA 94
            |...|.:.|.|...:|...|....:..:..|...:  ..||.:.|.||..|...:.:..|.:...
Yeast     9 GGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNL 73

  Fly    95 YRHSYNAEFPVRRLVSNLGNKLQTTTQ-----RYDRR--PYGVGLLVAGYDEQG--PHIYQVMPT 150
            |           :|......:.:|.||     .|:||  ||.||.:|||.:.:.  |.|    ..
Yeast    74 Y-----------KLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFI----AG 123

  Fly   151 ANVLNC-----KAMAIGSRSQS----ARTYLERNMESFEDCDMDELICHAIQAIRGSLGSDDVEN 206
            .:::.|     ..:..|:.|..    ..:..|.|:|..   |:.|.|.   ||:..:...|.:..
Yeast   124 FDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE---DLFETIS---QALLNAADRDALSG 182

  Fly   207 LTINVAIVGKDVPFKMFTEAENQKYVKL 234
            ....|.|:.||...|        :|:|:
Yeast   183 WGAVVYIIKKDEVVK--------RYLKM 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 49/220 (22%)
proteasome_alpha_type_1 6..215 CDD:239718 45/202 (22%)
PUP3NP_011020.3 proteasome_beta_type_3 8..201 CDD:239728 49/220 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.