DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and PRE2

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_015428.1 Gene:PRE2 / 856218 SGDID:S000006307 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:34/165 - (20%)
Similarity:68/165 - (41%) Gaps:21/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RKIMPVDDHVGMSIAGLTADARVVCQYMRT----ECMAYRHSYNAEFPV---RRLVSNLGNKLQT 118
            :|::.::..:..::||..||    ||:..|    :|..:.........|   .:::|||      
Yeast   107 KKVIEINPFLLGTMAGGAAD----CQFWETWLGSQCRLHELREKERISVAAASKILSNL------ 161

  Fly   119 TTQRYDRRPYGVGLLVAGYD-EQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDC 182
             ..:|......:|.::.||. ::||.||.|......|......:||....|...|:.|.:  .|.
Yeast   162 -VYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYK--WDL 223

  Fly   183 DMDELICHAIQAIRGSLGSDDVENLTINVAIVGKD 217
            .:::.:....::|..:...|.....::|:..|.:|
Yeast   224 SVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTED 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 34/165 (21%)
proteasome_alpha_type_1 6..215 CDD:239718 32/161 (20%)
PRE2NP_015428.1 proteasome_beta_type_5 76..264 CDD:239730 34/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.