DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and PRE9

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_011651.3 Gene:PRE9 / 853036 SGDID:S000003367 Length:258 Species:Saccharomyces cerevisiae


Alignment Length:262 Identity:86/262 - (32%)
Similarity:138/262 - (52%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAA---LCRTSKDTNTLQRK 62
            |...:||:.||.:||:|||:|||||:|::......:|:..:|..||||   :..|..:.:|...|
Yeast     1 MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65

  Fly    63 IMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRP 127
            :..::|.:.:::|||||||.::....|.....|..:||.:.||..||..|.:..|..||....||
Yeast    66 LYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRP 130

  Fly   128 YGVGLLVAGYDEQ-GPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHA 191
            :||..:.||||:: |..:|...|:.|....||:::|:.:.:|:|.|:  |:..:|..:|:.|..|
Yeast   131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDDMKVDDAIELA 193

  Fly   192 IQAI-----RGSLGSDDVENLTINVAIVGKDVPFKMFTEAENQKYVK--LVKA----MDPPLEAD 245
            ::.:     ..:|..|.:|..||.......:|..|:|...|    :|  |||.    .|...|||
Yeast   194 LKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQE----IKDILVKTGITKKDEDEEAD 254

  Fly   246 HD 247
            .|
Yeast   255 ED 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 76/237 (32%)
proteasome_alpha_type_1 6..215 CDD:239718 72/217 (33%)
PRE9NP_011651.3 proteasome_alpha_type_4 4..216 CDD:239721 70/213 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.