DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and SCL1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_011504.3 Gene:SCL1 / 852873 SGDID:S000002979 Length:252 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:76/239 - (31%)
Similarity:107/239 - (44%) Gaps:26/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDNDTTTWSPQGRLFQVEYAMEAVKQ-GAATVGLKGTDYAVLAALCRTSK---DTNTLQRKIMPV 66
            ||...|.:||:|||:|||||.:|..| ...::.::|.|..|:.:..:...   |..|:. .|..:
Yeast    12 YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVS-YIFCI 75

  Fly    67 DDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVG 131
            ...:||.:.|...|||......:.|...:|:.|..:.|...|...:.|..|..|||...||.||.
Yeast    76 SRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVI 140

  Fly   132 LLVAGYDEQ-GPHIYQVMPTANVLNCKAMAIGSRSQSARTYLER----------NMESFEDCDMD 185
            |.....||: ||.||:..|....:..||.|.|.:.|...|.||.          |.||:|.. ::
Yeast   141 LTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKV-VE 204

  Fly   186 ELICHAIQAIRGSLGSDDVENLTINVAIVGKDVPFKMFT-EAEN 228
            ..|.|.|.|:......:|:|     |.:..||   |.|| .|||
Yeast   205 FAITHMIDALGTEFSKNDLE-----VGVATKD---KFFTLSAEN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 76/239 (32%)
proteasome_alpha_type_1 6..215 CDD:239718 68/223 (30%)
SCL1NP_011504.3 proteasome_alpha_type_6 12..228 CDD:239723 68/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.