DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and PAB1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001031057.1 Gene:PAB1 / 838217 AraportID:AT1G16470 Length:235 Species:Arabidopsis thaliana


Alignment Length:244 Identity:81/244 - (33%)
Similarity:131/244 - (53%) Gaps:23/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSK-------DTNTLQR 61
            :||....||:||.|:|.|:|:|:.||..|..::|:|.::..|:|    |.|       |..::| 
plant     4 SQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIA----TEKKLPSILVDEASVQ- 63

  Fly    62 KIMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRR 126
            ||..:..::|:..:|:..|.||:.:..|.:...|...|....||.:||......:|..||....|
plant    64 KIQHLTPNIGVVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGGVR 128

  Fly   127 PYGVGLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHA 191
            |:||.|||||||::||.:|||.|:.:..:.||.|:|....:|:|:||:...  ||.::|:.|..|
plant   129 PFGVSLLVAGYDDKGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYT--EDMELDDAIHTA 191

  Fly   192 I----QAIRGSLGSDDVENLTINVAIVGKDVPFKMFTEAENQKYVKLVK 236
            |    :...|.:.|.::|     :..:|.|..|::.|.||...|:..|:
plant   192 ILTLKEGFEGEISSKNIE-----IGKIGADKVFRVLTPAEIDDYLAEVE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 80/239 (33%)
proteasome_alpha_type_1 6..215 CDD:239718 72/219 (33%)
PAB1NP_001031057.1 proteasome_alpha_type_2 6..232 CDD:239719 79/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.