DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and PAF1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_199093.1 Gene:PAF1 / 834290 AraportID:AT5G42790 Length:278 Species:Arabidopsis thaliana


Alignment Length:281 Identity:128/281 - (45%)
Similarity:174/281 - (61%) Gaps:7/281 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQRKIMP 65
            |||||||.|.|||||.||||||||||||||||:|.:||:...:.|||.:.:...:.::.||||..
plant     1 MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQRKIFK 65

  Fly    66 VDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGV 130
            ||||:|::|||||||.||:.:|||:|.:.:..:|.:..||.|||.:|.:|.|..|||..:|||||
plant    66 VDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGV 130

  Fly   131 GLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAI 195
            ||||.|.||.|.|:|...|:.|....:|.|||||||:|:|||||..|||.|...::||..||.|:
plant   131 GLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESFGDSSREDLIKDAILAV 195

  Fly   196 RGSLGSDDVENLTINVAIVGKDVPFKMFTEAENQKYVKLVKAMDPPLEADHDPLSEEGMSDDDMT 260
            |.:|..:.:::....|||:|.|.||....:...||.:...:.:....|.:    .|.|..:.:..
plant   196 RETLQGETLKSSLCTVAILGVDEPFHFLDQEAIQKVIDTFEKVPEEEEGE----GEAGEGEAEAA 256

  Fly   261 DHGPSSSG---VPPNDTSDME 278
            :..|:..|   ....|.:.||
plant   257 EAAPAERGGGVAGDQDVAPME 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 117/228 (51%)
proteasome_alpha_type_1 6..215 CDD:239718 109/208 (52%)
PAF1NP_199093.1 proteasome_alpha_type_1 6..215 CDD:239718 109/208 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 183 1.000 Domainoid score I1012
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2080
Inparanoid 1 1.050 248 1.000 Inparanoid score I1037
OMA 1 1.010 - - QHG53705
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003679
OrthoInspector 1 1.000 - - mtm980
orthoMCL 1 0.900 - - OOG6_102143
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2552
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.