DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and PAD1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_190694.1 Gene:PAD1 / 824289 AraportID:AT3G51260 Length:250 Species:Arabidopsis thaliana


Alignment Length:248 Identity:85/248 - (34%)
Similarity:125/248 - (50%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQ-----RKIM 64
            :||...|.:||.|.|||||||:|||::|.|.||::|||..|||.   ..|.|..||     |||:
plant     3 RYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAV---EKKSTPKLQDSRSARKIV 64

  Fly    65 PVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYG 129
            .:|:|:.::.|||.|||||:....|.||.::|.:......|..:...:....|..||....||:|
plant    65 SLDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFG 129

  Fly   130 VGLLVAGYD--EQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAI 192
            :..|:.|:|  .:.|.:||..|:......||.|.|..|.|.|.:||:|.:.....:..:|...|:
plant   130 LSTLIVGFDPYTRIPALYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKESAGQETVKLAIRAL 194

  Fly   193 QAIRGSLGSDDVENLTINVAIVGKDV-PFKMFTEAENQKYVKLVKAMDPPLEA 244
            ..:..|.|.:      |.||::.::. ..|...|.|....|..::|.....||
plant   195 LEVVESGGKN------IEVAVMTREEGVLKQLEEEEIDIIVAEIEAEKAAAEA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 81/235 (34%)
proteasome_alpha_type_1 6..215 CDD:239718 78/215 (36%)
PAD1NP_190694.1 proteasome_alpha_type_7 4..210 CDD:239724 78/214 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.